Skip to product information
1 of 1

CD300LF, Human (His)

CD300LF, Human (His)

Size

SKU:QM-0198611-01

£124.00 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The CD300LF protein acts as a multifunctional immunomodulator, acting as an inhibitory receptor on myeloid cells and mast cells. It plays a vital role in immune homeostasis by actively regulating the phagocytosis of apoptotic cells by binding to phosphatidylserine. CD300LF Protein, Human (His) is the recombinant human-derived CD300LF protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    146722 (Gene_ID) Q8TDQ1-1 (T20-S156) (Accession)

  • Smiles

    TQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKLS

  • Purity

    90

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0198611-01
5 µgQM-0198611-01
£124.00/ea
£0.00
£124.00/ea £0.00
10 µgQM-0198611-02
10 µgQM-0198611-02
£232.25/ea
£0.00
£232.25/ea £0.00
50 µgQM-0198611-03
50 µgQM-0198611-03
£559.09/ea
£0.00
£559.09/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CD300LF, Human (His)

CD300LF, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.