CD300LF, Mouse (HEK293, Fc)

Name: CD300LF, Mouse (HEK293, Fc)
Brand: QuantiMol
SKU: QM-0203827-01
Price: 81.92 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0203827-01

£81.92 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The CD300LF protein, also known as DEC-205/CD205, directs antigens to the antigen-processing compartment. It inhibits myeloid cells and mast cells and promotes phagocytosis of apoptotic cells. CD300LF Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD300LF protein, expressed by HEK293 , with C-mFc labeled tag.
Molecular Formula
246746 (Gene_ID) Q6SJQ7 (E20-S193) (Accession)
Smiles
EDPVTGPEEVSGQEQGSLTVQCRYTSGWKDYKKYWCQGVPQRSCKTLVETDASEQLVKKNRVSIRDNQRDFIFTVTMEDLRMSDAGIYWCGITKGGLDPMFKVTVNIGPAIQVPITVPTMPPITSTTTIFTVTTTVKETSMFPTLTSYYSDNGHGGGDSGGGEDGVGDGFLDLS
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0203827-01	5 µgQM-0203827-01 £81.92/ea	£0.00	Quantity	£81.92/ea	£0.00

10 µgQM-0203827-02	10 µgQM-0203827-02 £127.38/ea	£0.00	Quantity	£127.38/ea	£0.00

50 µgQM-0203827-03	50 µgQM-0203827-03 £359.82/ea	£0.00	Quantity	£359.82/ea	£0.00

100 µgQM-0203827-04	100 µgQM-0203827-04 £576.10/ea	£0.00	Quantity	£576.10/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CD300LF, Mouse (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.