Skip to product information
1 of 1

CD300LF, Rat (Myc, His-SUMO)

CD300LF, Rat (Myc, His-SUMO)

Size

SKU:QM-0092453

Price on request
Quantity

Request quote or documents

View full details
  • Description

    CMRF35-like molecule 1 (CLM-1) protein serves as an inhibitory receptor on myeloid cells and mast cells and is critical for immune homeostasis by regulating various immune responses. CLM-1 positively regulates macrophage-mediated endocytosis by recognizing phosphatidylserine on apoptotic cells. CD300LF Protein, Rat (Myc, His-SUMO) is the recombinant rat-derived CMRF35-like molecule 1 protein, expressed by E. coli , with N-His, C-Myc, N-SUMO labeled tag.

  • Molecular Formula

    287818 (Gene_ID) Q566E6 (A19-S181) (Accession)

  • Smiles

    AQDPVTGPEEVSGYEQGSLTVWCRYGSWWKDYSKYWCRGPKRSSCEIRVETDASERLVKENHVSIRDDQTNFTFTVTMEDLRMSDAGIYWCGITKAGYDHMFKVHVSINPVPTTPTTTSTTTIFTVTTTVKETSTLSTQTSHYSDNRYDSGGVGDGNGFLDLS

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0092453
1 EachQM-0092453
£0.00/ea
£0.00
£0.00/ea £0.00

CD300LF, Rat (Myc, His-SUMO)

CD300LF, Rat (Myc, His-SUMO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.