CD300LF, Rat (Myc, His-SUMO)
CD300LF, Rat (Myc, His-SUMO)
SKU:QM-0092453
Request quote or documents

Product Details
-
Description
CMRF35-like molecule 1 (CLM-1) protein serves as an inhibitory receptor on myeloid cells and mast cells and is critical for immune homeostasis by regulating various immune responses. CLM-1 positively regulates macrophage-mediated endocytosis by recognizing phosphatidylserine on apoptotic cells. CD300LF Protein, Rat (Myc, His-SUMO) is the recombinant rat-derived CMRF35-like molecule 1 protein, expressed by E. coli , with N-His, C-Myc, N-SUMO labeled tag.
-
Molecular Formula
287818 (Gene_ID) Q566E6 (A19-S181) (Accession)
-
Smiles
AQDPVTGPEEVSGYEQGSLTVWCRYGSWWKDYSKYWCRGPKRSSCEIRVETDASERLVKENHVSIRDDQTNFTFTVTMEDLRMSDAGIYWCGITKAGYDHMFKVHVSINPVPTTPTTTSTTTIFTVTTTVKETSTLSTQTSHYSDNRYDSGGVGDGNGFLDLS
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
CD300LF, Rat (Myc, His-SUMO)
CD300LF, Rat (Myc, His-SUMO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.