Skip to product information
1 of 1

CD31/PECAM-1, Mouse (HEK293, His)

CD31/PECAM-1, Mouse (HEK293, His)

Size

SKU:QM-0197093-01

£110.50 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The CD31/PECAM-1 protein is a cell adhesion molecule critical for leukocyte transendothelial migration (TEM) under inflammatory conditions.CD31/PECAM-1 also regulates bradykinin receptor BDKRB2 activation and modulates ERK1/2 activation in endothelial cells.CD31/PECAM-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD31/PECAM-1 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    18613 (Gene_ID) Q08481 (E18-K590) (Accession)

  • Smiles

    EENSFTINSIHMESLPSWEVMNGQQLTLECLVDISTTSKSRSQHRVLFYKDDAMVYNVTSREHTESYVIPQARVFHSGKYKCTVMLNNKEKTTIEYEVKVHGVSKPKVTLDKKEVTEGGVVTVNCSLQEEKPPIFFKIEKLEVGTKFVKRRIDKTSNENFVLMEFPIEAQDHVLVFRCQAGILSGFKLQESEPIRSEYVTVQESFSTPKFEIKPPGMIIEGDQLHIRCIVQVTHLVQEFTEIIIQKDKAIVATSKQSSEAVYSVMAMVEYSGHYTCKVESNRISKASSIMVNITELFPKPKLEFSSSRLDQGELLDLSCSVSGTPVANFTIQKEETVLSQYQNFSKIAEESDSGEYSCTAGIGKVVKRSGLVPIQVCEMLSKPSIFHDAKSEIIKGHAIGISCQSENGTAPITYHLMKAKSDFQTLEVTSNDPATFTDKPTRDMEYQCRADNCHSHPAVFSEILRVRVIAPVDEVVISILSSNEVQSGSEMVLRCSVKEGTSPITFQFYKEKEDRPFHQAVVNDTQAFWHNKQASKKQEGQYYCTASNRASSMRTSPRSSTLAVRVFLAPWKK

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0197093-01
5 µgQM-0197093-01
£110.50/ea
£0.00
£110.50/ea £0.00
10 µgQM-0197093-02
10 µgQM-0197093-02
£205.52/ea
£0.00
£205.52/ea £0.00
50 µgQM-0197093-03
50 µgQM-0197093-03
£483.75/ea
£0.00
£483.75/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CD31/PECAM-1, Mouse (HEK293, His)

CD31/PECAM-1, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.