CD3D-CD3E Heterodimer, Human (HEK293, His)

Name: CD3D-CD3E Heterodimer, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0172934-01
Price: 271.13 GBP
Availability: InStock

Size 20 µg 50 µg 100 µg

SKU:QM-0172934-01

£271.13 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
CD3D protein is a component of the TCR-CD3 complex on T lymphocytes and plays a key role in adaptive immunity. It transmits signals through the CD3D, CD3E, CD3G, and CD3Z chains upon TCR engagement. CD3D-CD3E Heterodimer Protein, Human (HEK293, His) is a recombinant protein dimer complex containing human-derived CD3D-CD3E Heterodimer protein, expressed by HEK293 , with C-6*His labeled tag. CD3D-CD3E Heterodimer Protein, Human (HEK293, His), has molecular weight of 16-30 kDa.
Molecular Formula
915&916 (Gene_ID) P04234-1 (F22-A105) &P07766 (D23-D126) (Accession)
Smiles
FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVA&DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
20 µgQM-0172934-01	20 µgQM-0172934-01 £271.13/ea	£0.00	Quantity	£271.13/ea	£0.00

50 µgQM-0172934-02	50 µgQM-0172934-02 £465.53/ea	£0.00	Quantity	£465.53/ea	£0.00

100 µgQM-0172934-03	100 µgQM-0172934-03 £714.61/ea	£0.00	Quantity	£714.61/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CD3D-CD3E Heterodimer, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.