Skip to product information
1 of 1

CD40, Human (Biotinylated, HEK293, Fc-Avi)

CD40, Human (Biotinylated, HEK293, Fc-Avi)

Size

SKU:QM-0075487

Price on request
Quantity

Request quote or documents

View full details
  • Description

    CD40 protein is a TNFSF5/CD40LG receptor that transduces signals through TRAF6 and MAP3K8-mediated pathways, activates ERK in macrophages and B cells, and induces immunoglobulin secretion. CD40 exists as monomers and homodimers and interacts with TRAF proteins (TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6) . CD40 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived CD40 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag.

  • Molecular Formula

    958 (Gene_ID) P25942-1 (E21-R193) (Accession)

  • Smiles

    MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0075487
1 EachQM-0075487
£0.00/ea
£0.00
£0.00/ea £0.00

CD40, Human (Biotinylated, HEK293, Fc-Avi)

CD40, Human (Biotinylated, HEK293, Fc-Avi) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.