Skip to product information
1 of 1

CD40, Human (HEK293, His)

CD40, Human (HEK293, His)

Size

SKU:QM-0202492-01

£52.94 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    CD40 protein is a TNFSF5/CD40LG receptor that transduces signals through TRAF6 and MAP3K8-mediated pathways, activates ERK in macrophages and B cells, and induces immunoglobulin secretion. CD40 exists as monomers and homodimers and interacts with TRAF proteins (TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6) . CD40 Protein, Human (HEK293, C-His) is the recombinant human-derived CD40 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    958 (Gene_ID) P25942-1 (E21-R193) (Accession)

  • Smiles

    EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0202492-01
2 µgQM-0202492-01
£52.94/ea
£0.00
£52.94/ea £0.00
10 µgQM-0202492-02
10 µgQM-0202492-02
£76.75/ea
£0.00
£76.75/ea £0.00
50 µgQM-0202492-03
50 µgQM-0202492-03
£137.50/ea
£0.00
£137.50/ea £0.00
100 µgQM-0202492-04
100 µgQM-0202492-04
£238.32/ea
£0.00
£238.32/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CD40, Human (HEK293, His)

CD40, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.