Skip to product information
1 of 1

CD40L/CD154/TRAP, Rabbit (His)

CD40L/CD154/TRAP, Rabbit (His)

Size

SKU:QM-0201411-01

£101.50 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    CD40L (CD154; TRAP) is a ligand to CD40/TNFRSF5, acts function by generating a costimulatory signal that up-regulates IL-4 synthesis[1]. CD40L is specifically expressed on activated CD4+ T-lymphocytes and involves in activation of NF-κB/MAPK pathway[2][3]. CD40L also involves in B cell differentiation, maturation, and apoptosis[4]. CD40L in Rabbit, cleaved into a soluble form, acts as a ligand for integrins (ITGA5:ITGB1 and ITGAV:ITGB3) . CD40L/CD154/TRAP Protein, Rabbit (His) has a total length of 149 amino acids (M113-L261), is expressed in E. coli cells with N-terminal 6*His-tag.

  • Molecular Formula

    100358388 (Gene_ID) G1SKP7 (M113-L261) (Accession)

  • Smiles

    MQKGDQDPQIAAHLISEASSKSSSVLQWAKKGYYTMSNTLVTLENGKQLKVKRQGFYYIYAQVTFCSNQEPSSQAPFIASLCLKSSGGSERILLRAANARSSSKTCEQQSIHLGGVFELQADASVFVNVTDASQVNHGTGFTSFGLLKL

  • Purity

    94

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0201411-01
5 µgQM-0201411-01
£101.50/ea
£0.00
£101.50/ea £0.00
10 µgQM-0201411-02
10 µgQM-0201411-02
£188.51/ea
£0.00
£188.51/ea £0.00
50 µgQM-0201411-03
50 µgQM-0201411-03
£437.58/ea
£0.00
£437.58/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CD40L/CD154/TRAP, Rabbit (His)

CD40L/CD154/TRAP, Rabbit (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.