CD40L/CD154/TRAP, Rabbit (P. pastoris, His)

CD40L/CD154/TRAP Protein, a cytokine, acts as a CD40/TNFRSF5 ligand, stimulating T-cell proliferation and cytokine production. It also facilitates immunoglobulin class switching and binds to integrins ITGA5:ITGB1 and ITGAV:ITGB3. CD40-CD40LG signaling requires both integrins and the CD40 receptor, leading to cell-type dependent effects like B-cell activation, NF-kappa-B signaling, and anti-apoptotic signaling. CD40L/CD154/TRAP Protein, Rabbit (P. pastoris, His) is the recombinant Rabbit-derived CD40L/CD154/TRAP protein, expressed by P. pastoris , with N-6*His labeled tag.

100358388 (Gene_ID) G1SKP7 (M113-L261) (Accession)

MQKGDQDPQIAAHLISEASSKSSSVLQWAKKGYYTMSNTLVTLENGKQLKVKRQGFYYIYAQVTFCSNQEPSSQAPFIASLCLKSSGGSERILLRAANARSSSKTCEQQSIHLGGVFELQADASVFVNVTDASQVNHGTGFTSFGLLKL

90

Stored at -20°C for 2 years

Room temperature in continental US; may vary elsewhere.