CD43, Mouse (HEK293, Fc)

Name: CD43, Mouse (HEK293, Fc)
Brand: QuantiMol
SKU: QM-0203524-01
Price: 89.13 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0203524-01

£89.13 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
CD43 (mouse) is a major leukocyte surface sialic acid protein that plays a critical regulatory role in T cell function.It positively affects the activation, proliferation, differentiation, trafficking and migration of T cells, particularly by enhancing migration to lymph nodes through ERM proteins.CD43 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD43 protein, expressed by HEK293 , with C-hFc labeled tag.
Molecular Formula
20737 (Gene_ID) P15702 (D20-G248) (Accession)
Smiles
DSLQRTTMLPSTPHITAPSTSEAQNASPSVSVGSGTVDSKETISPWGQTTIPVSLTPLETTELSSLETSAGASMSTPVPEPTASQEVSSKTSALLPEPSNVASDPPVTAANPVTDGPAANPVTDGTAASTSISKGTSAPPTTVTTSSNETSGPSVATTVSSKTSGPPVTTATGSLGPSSEMHGLPATTATSSVESSSVARGTSVSSRKTSTTSTQDPITTRSPSQESSG
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0203524-01	5 µgQM-0203524-01 £89.13/ea	£0.00	Quantity	£89.13/ea	£0.00

10 µgQM-0203524-02	10 µgQM-0203524-02 £134.13/ea	£0.00	Quantity	£134.13/ea	£0.00

50 µgQM-0203524-03	50 µgQM-0203524-03 £381.69/ea	£0.00	Quantity	£381.69/ea	£0.00

100 µgQM-0203524-04	100 µgQM-0203524-04 £614.98/ea	£0.00	Quantity	£614.98/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CD43, Mouse (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.