Name: CD44, Mouse (HEK293, His)
Brand: QuantiMol
SKU: QM-0205810-01
Price: 58.12 GBP
Availability: InStock

Product Details

Description
The CD44 protein binds to hyaluronic acid and TGF-β receptors and contributes to cytokine function. CD44 is involved in T cell activation, protein phosphorylation, and Wnt signaling and is strategically located in the plasma membrane and microvilli. CD44 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD44 protein, expressed by HEK293 , with C-His labeled tag.
Molecular Formula
12505 (Gene_ID) NP_001034240.1 (Q25-T224) (Accession)
Smiles
QIDLNVTCRYAGVFHVEKNGRYSISRTEAADLCQAFNSTLPTMDQMKLALSKGFETCRYGFIEGNVVIPRIHPNAICAANHTGVYILVTSNTSHYDTYCFNASAPPEEDCTSVTDLPNSFDGPVTITIVNRDGTRYSKKGEYRTHQEDIDASNIIDDDVSSGSTIEKSTPESYILHTYLPTEQPTGDQDDSFFIRSTLAT
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0205810-01	5 µgQM-0205810-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0205810-02	10 µgQM-0205810-02 £81.92/ea	£0.00	Quantity	£81.92/ea	£0.00

50 µgQM-0205810-03	50 µgQM-0205810-03 £238.32/ea	£0.00	Quantity	£238.32/ea	£0.00

100 µgQM-0205810-04	100 µgQM-0205810-04 £370.76/ea	£0.00	Quantity	£370.76/ea	£0.00

500 µgQM-0205810-05	500 µgQM-0205810-05 £951.53/ea	£0.00	Quantity	£951.53/ea	£0.00

1 mgQM-0205810-06	1 mgQM-0205810-06 £1,577.26/ea	£0.00	Quantity	£1,577.26/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CD44, Mouse (HEK293, His)

CD44, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.