Skip to product information
1 of 1

CD47, Human (Biotinylated, HEK293, Avi-His)

CD47, Human (Biotinylated, HEK293, Avi-His)

Size

SKU:QM-0201045-01

£492.26 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    CD47 is an adhesion protein that regulates integrin signaling through G protein activation and serves as a receptor for thrombospondin THBS1, affecting signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, self-renewal and Immunomodulatory. It regulates pulmonary endothelin EDN1 signaling, acts as a pressor in blood pressure regulation, and is critical for memory formation. CD47 Protein, Human (Biotinylated, HEK293, Avi-His) is the recombinant human-derived CD47 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

  • Molecular Formula

    961 (Gene_ID) Q08722-1 (Q19-P139) (Accession)

  • Smiles

    QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

  • Purity

    99

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
20 µgQM-0201045-01
20 µgQM-0201045-01
£492.26/ea
£0.00
£492.26/ea £0.00
50 µgQM-0201045-02
50 µgQM-0201045-02
£847.04/ea
£0.00
£847.04/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CD47, Human (Biotinylated, HEK293, Avi-His)

CD47, Human (Biotinylated, HEK293, Avi-His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.