Skip to product information
1 of 1

CD47, Human (HEK293)

CD47, Human (HEK293)

Size

SKU:QM-0202619-01

£77.78 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    CD47 is an adhesion protein that regulates integrin signaling through G protein activation and serves as a receptor for thrombospondin THBS1, affecting signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, self-renewal and Immunomodulatory. It regulates pulmonary endothelin EDN1 signaling, acts as a pressor in blood pressure regulation, and is critical for memory formation. CD47 Protein, Human (HEK293) is the recombinant human-derived CD47 protein, expressed by HEK293 , with tag free.

  • Molecular Formula

    961 (Gene_ID) Q08722-1/NP_942088.1 (Q19-P139) (Accession)

  • Smiles

    MWPLVAALLLGSACCGSAQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0202619-01
5 µgQM-0202619-01
£77.78/ea
£0.00
£77.78/ea £0.00
10 µgQM-0202619-02
10 µgQM-0202619-02
£122.88/ea
£0.00
£122.88/ea £0.00
50 µgQM-0202619-03
50 µgQM-0202619-03
£342.81/ea
£0.00
£342.81/ea £0.00
100 µgQM-0202619-04
100 µgQM-0202619-04
£548.15/ea
£0.00
£548.15/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CD47, Human (HEK293)

CD47, Human (HEK293) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.