CD47, Mouse (HEK293)

Name: CD47, Mouse (HEK293)
Brand: QuantiMol
SKU: QM-0203600-01
Price: 60.19 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0203600-01

£60.19 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The CD47 protein, also known as integrin-associated protein (IAP), is an immune checkpoint protein. CD47 binds to membrane integrins and binds ligands platelet reaction-protein-1 (TSP-1) and signal regulatory protein alpha (SIRP) . CD47 is a potential therapeutic target for some cancers and is also used to treat pulmonary fibrosis. CD47 Protein, Mouse (HEK293) is the recombinant mouse-derived CD47 protein, expressed by HEK293 , with tag free.
Molecular Formula
16423 (Gene_ID) Q61735-1/ADQ12919.1 (Q19-K140) (Accession)
Smiles
QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEK
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0203600-01	5 µgQM-0203600-01 £60.19/ea	£0.00	Quantity	£60.19/ea	£0.00

10 µgQM-0203600-02	10 µgQM-0203600-02 £89.13/ea	£0.00	Quantity	£89.13/ea	£0.00

50 µgQM-0203600-03	50 µgQM-0203600-03 £243.19/ea	£0.00	Quantity	£243.19/ea	£0.00

100 µgQM-0203600-04	100 µgQM-0203600-04 £381.69/ea	£0.00	Quantity	£381.69/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CD47, Mouse (HEK293) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.