Name: CD5, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0205850-01
Price: 58.12 GBP
Availability: InStock

Product Details

Description
The CD5 protein is a potential receptor that regulates T cell proliferation. Its interactions with CD72/LYB-2 and PTPN6/SHP-1 indicate multifaceted roles in cellular processes, serving as key mediators of T cell responses. CD5 Protein, Human (HEK293, His) is the recombinant human-derived CD5 protein, expressed by HEK293 , with C-His labeled tag.
Molecular Formula
921 (Gene_ID) P06127 (R25-P372) (Accession)
Smiles
RLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNP
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0205850-01	5 µgQM-0205850-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0205850-02	10 µgQM-0205850-02 £72.61/ea	£0.00	Quantity	£72.61/ea	£0.00

50 µgQM-0205850-03	50 µgQM-0205850-03 £205.52/ea	£0.00	Quantity	£205.52/ea	£0.00

100 µgQM-0205850-04	100 µgQM-0205850-04 £316.08/ea	£0.00	Quantity	£316.08/ea	£0.00

500 µgQM-0205850-05	500 µgQM-0205850-05 £890.78/ea	£0.00	Quantity	£890.78/ea	£0.00

1 mgQM-0205850-06	1 mgQM-0205850-06 £1,555.38/ea	£0.00	Quantity	£1,555.38/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CD5, Human (HEK293, His)

CD5, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.