CD53, Cynomolgus (HEK293, His)

Name: CD53, Cynomolgus (HEK293, His)
Brand: QuantiMol
SKU: QM-0202799-01
Price: 68.47 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0202799-01

£68.47 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
CD53 protein is an important member of the tetraspanin family and plays an important role in immune response, cell adhesion and signal transduction. Its research enhances understanding of cell membrane organization and function, with potential applications in immunology and cancer research. CD53 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD53 protein, expressed by HEK293 , with N-His labeled tag.
Molecular Formula
102127943 (Gene_ID) G7NW46 (E107-N181) (Accession)
Smiles
EQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDPNVEGCYAKARLWFHSN
Purity
96
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0202799-01	5 µgQM-0202799-01 £68.47/ea	£0.00	Quantity	£68.47/ea	£0.00

10 µgQM-0202799-02	10 µgQM-0202799-02 £101.50/ea	£0.00	Quantity	£101.50/ea	£0.00

50 µgQM-0202799-03	50 µgQM-0202799-03 £288.14/ea	£0.00	Quantity	£288.14/ea	£0.00

100 µgQM-0202799-04	100 µgQM-0202799-04 £426.65/ea	£0.00	Quantity	£426.65/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CD53, Cynomolgus (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.