CD55/DAF, Human (HEK293, His)

Name: CD55/DAF, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0171269-01
Price: 127.38 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0171269-01

£127.38 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The CD55/DAF protein is critical in the immune system, recognizing C4b and C3b fragments, interfering with their enzymatic conversion and preventing the formation of complement cascade amplifying convertase. This regulatory mechanism alleviates complement-induced damage by inhibiting complement activation. CD55/DAF Protein, Human (HEK293, His) is the recombinant human-derived CD55/DAF protein, expressed by HEK293 , with C-6*His labeled tag.
Molecular Formula
1604 (Gene_ID) P08174 (D35-S353) (Accession)
Smiles
DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTS
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0171269-01	10 µgQM-0171269-01 £127.38/ea	£0.00	Quantity	£127.38/ea	£0.00

50 µgQM-0171269-02	50 µgQM-0171269-02 £359.82/ea	£0.00	Quantity	£359.82/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CD55/DAF, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.