Skip to product information
1 of 1

CD58, Human (HEK293, His)

CD58, Human (HEK293, His)

Size

SKU:QM-0203699-01

£58.12 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    CD58, a glycoprotein, is also known as lymphocyte-function antigen 3 (LFA-3) . CD58 is a costimulatory receptor, and can interact with its natural ligand (CD2, primarily expressed on the surface of T/NK cells) . The CD2-CD58 interaction can promote cell adhesion and recognition, and regulate antiviral responses, inflammatory responses in autoimmune diseases, immune rejection of transplantation, and immune evasion of tumor cells[1]. CD58 Protein, Human (HEK293, His) is the recombinant human-derived CD58 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    965 (Gene_ID) AAH05930 (F29-R215) (Accession)

  • Smiles

    FSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEYYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHR

  • Purity

    99.9

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0203699-01
5 µgQM-0203699-01
£58.12/ea
£0.00
£58.12/ea £0.00
10 µgQM-0203699-02
10 µgQM-0203699-02
£81.92/ea
£0.00
£81.92/ea £0.00
50 µgQM-0203699-03
50 µgQM-0203699-03
£232.25/ea
£0.00
£232.25/ea £0.00
100 µgQM-0203699-04
100 µgQM-0203699-04
£359.82/ea
£0.00
£359.82/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CD58, Human (HEK293, His)

CD58, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.