Skip to product information
1 of 1

CD63, Human/Cynomolgus (HEK293, His)

CD63, Human/Cynomolgus (HEK293, His)

Size

SKU:QM-0202927-01

£68.47 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The CD63 protein serves as a cell surface receptor for TIMP1 and is critical for activating signaling cascades. It contributes to ITGB1 and integrin signaling, activating AKT, FAK/PTK2 and MAP kinases to promote cell survival, cytoskeletal reorganization, adhesion, spreading and migration. CD63 Protein, Human/Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD63 protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    967/709828 (Gene_ID) P08962-1/NP_001253224 (A103-V203) (Accession)

  • Smiles

    AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0202927-01
5 µgQM-0202927-01
£68.47/ea
£0.00
£68.47/ea £0.00
10 µgQM-0202927-02
10 µgQM-0202927-02
£101.50/ea
£0.00
£101.50/ea £0.00
50 µgQM-0202927-03
50 µgQM-0202927-03
£288.14/ea
£0.00
£288.14/ea £0.00
100 µgQM-0202927-04
100 µgQM-0202927-04
£426.65/ea
£0.00
£426.65/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CD63, Human/Cynomolgus (HEK293, His)

CD63, Human/Cynomolgus (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.