Skip to product information
1 of 1

CD63, Mouse (GST)

CD63, Mouse (GST)

Size

SKU:QM-0169809-01

£220.10 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The CD63 protein is an important cell surface receptor that activates multiple signaling cascades. It plays a role in integrin signaling, leading to activation of AKT, FAK/PTK2, and MAP kinases. CD63 Protein, Mouse (GST) is the recombinant mouse-derived CD63 protein, expressed by E. coli , with N-GST labeled tag.

  • Molecular Formula

    12512 (Gene_ID) P41731 (A103-I203) (Accession)

  • Smiles

    AGYVFRDQVKSEFNKSFQQQMQNYLKDNKTATILDKLQKENNCCGASNYTDWENIPGMAKDRVPDSCCINITVGCGNDFKESTIHTQGCVETIAIWLRKNI

  • Purity

    90

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0169809-01
5 µgQM-0169809-01
£220.10/ea
£0.00
£220.10/ea £0.00
10 µgQM-0169809-02
10 µgQM-0169809-02
£340.38/ea
£0.00
£340.38/ea £0.00
50 µgQM-0169809-03
50 µgQM-0169809-03
£862.84/ea
£0.00
£862.84/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CD63, Mouse (GST)

CD63, Mouse (GST) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.