Skip to product information
1 of 1

CD7, Mouse (HEK293, His)

CD7, Mouse (HEK293, His)

Size

SKU:QM-0173521-01

£143.13 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    CD7 protein's functional role remains unclear, with its specific cellular activities and interactions, particularly with SECTM1, yet to be fully elucidated. Further research is essential for a comprehensive understanding of CD7 protein's functional significance and its potential involvement in various cellular processes. CD7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD7 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    12516 (Gene_ID) P50283 (Q24-P150) (Accession)

  • Smiles

    QDVHQSPRLTIASEGDSVNITCSTRGHLEGILMKKIWPQAYNVIYFEDRQEPTVDRTFSGRINFSGSQKNLTITISSLQLADTGDYTCEAVRKVSARGLFTTVVVKEKSSQEAYRSQEPLQTSFSFP

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0173521-01
10 µgQM-0173521-01
£143.13/ea
£0.00
£143.13/ea £0.00
50 µgQM-0173521-02
50 µgQM-0173521-02
£431.51/ea
£0.00
£431.51/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CD7, Mouse (HEK293, His)

CD7, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.