Skip to product information
1 of 1

CD74, Human (HEK293, His)

CD74, Human (HEK293, His)

Size

SKU:QM-0203695-01

£81.92 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    CD74 is a key component of the class II major histocompatibility complex and serves as a key chaperone in antigen presentation in the regulation of immune responses. It doubles as a cell surface receptor for macrophage migration inhibitory factor (MIF), initiating survival pathways and cell proliferation. CD74 Protein, Human (HEK293, His) is the recombinant human-derived CD74 protein, expressed by HEK293 , with N-His labeled tag.

  • Molecular Formula

    972 (Gene_ID) NP_004346.1 (Q73-M232) (Accession)

  • Smiles

    QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0203695-01
5 µgQM-0203695-01
£81.92/ea
£0.00
£81.92/ea £0.00
10 µgQM-0203695-02
10 µgQM-0203695-02
£122.88/ea
£0.00
£122.88/ea £0.00
50 µgQM-0203695-03
50 µgQM-0203695-03
£354.96/ea
£0.00
£354.96/ea £0.00
100 µgQM-0203695-04
100 µgQM-0203695-04
£537.21/ea
£0.00
£537.21/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CD74, Human (HEK293, His)

CD74, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.