CD79A, Human (HEK293, His)

Name: CD79A, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0135633-01
Price: 127.38 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0135633-01

£127.38 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The CD79A protein is critical for initiating the B cell antigen receptor complex (BCR) signaling cascade upon antigen binding. It promotes internalization, transport to late endosomes, and antigen presentation of BCR complexes. CD79A Protein, Human (HEK293, His) is the recombinant human-derived CD79A protein, expressed by HEK293 , with C-6*His labeled tag.
Molecular Formula
973 (Gene_ID) P11912-1 (L33-R143) (Accession)
Smiles
LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNR
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0135633-01	10 µgQM-0135633-01 £127.38/ea	£0.00	Quantity	£127.38/ea	£0.00

50 µgQM-0135633-02	50 µgQM-0135633-02 £359.82/ea	£0.00	Quantity	£359.82/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CD79A, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.