1 1

CD79B, Human (Biotinylated, HEK293, His-Avi)

CD79B, Human (Biotinylated, HEK293, His-Avi)

Size

QM-0173451-01

£337.95 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    CD79B protein binds to CD79A and initiates the B cell antigen receptor complex (BCR) signaling cascade. This results in complex internalization, transport to late endosomes and antigen presentation. CD79B Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD79B protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

  • Molecular Formula

    974 (Gene_ID) P40259 (A29-D159) (Accession)

  • Smiles

    ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
20 µgQM-0173451-01
20 µgQM-0173451-01
£337.95/ea		 £0.00
£337.95/ea £0.00
100 µgQM-0173451-02
100 µgQM-0173451-02
£836.11/ea		 £0.00
£836.11/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

CD79B, Human (Biotinylated, HEK293, His-Avi)

CD79B, Human (Biotinylated, HEK293, His-Avi) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.