Name: CD8 alpha, Rat (HEK293, Fc)
Brand: QuantiMol
SKU: QM-0205905-01
Price: 72.61 GBP
Availability: InStock

Product Details

Description
CD8 alpha is an important immune glycoprotein that serves as a coreceptor for MHC class I:peptide complexes, linking T cells to antigens presented by APCs.It interacts with TCR and MHC class I, recruits LCK kinase, and initiates multiple signaling pathways.CD8 alpha Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD8 alpha protein, expressed by HEK293 , with C-hFc labeled tag.
Molecular Formula
24930 (Gene_ID) P07725 (Q27-Y189) (Accession)
Smiles
QLQLSPKKVDAEIGQEVKLTCEVLRDTSQGCSWLFRNSSSELLQPTFIIYVSSSRSKLNDILDPNLFSARKENNKYILTLSKFSTKNQGYYFCSITSNSVMYFSPLVPVFQKVNSIITKPVTRAPTPVPPPTGTPRPLRPEACRPGASGSVEGMGLGFACDIY
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0205905-01	5 µgQM-0205905-01 £72.61/ea	£0.00	Quantity	£72.61/ea	£0.00

10 µgQM-0205905-02	10 µgQM-0205905-02 £107.13/ea	£0.00	Quantity	£107.13/ea	£0.00

50 µgQM-0205905-03	50 µgQM-0205905-03 £288.14/ea	£0.00	Quantity	£288.14/ea	£0.00

100 µgQM-0205905-04	100 µgQM-0205905-04 £426.65/ea	£0.00	Quantity	£426.65/ea	£0.00

500 µgQM-0205905-05	500 µgQM-0205905-05 £1,212.76/ea	£0.00	Quantity	£1,212.76/ea	£0.00

1 mgQM-0205905-06	1 mgQM-0205905-06 £1,908.95/ea	£0.00	Quantity	£1,908.95/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CD8 alpha, Rat (HEK293, Fc)

CD8 alpha, Rat (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.