1 1

CD81, Cynomolgus/Rhesus Macaque (HEK293, His)

CD81, Cynomolgus/Rhesus Macaque (HEK293, His)

Size

QM-0202965-01

£72.61 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    The CD81 protein is a member of the growth hormone/prolactin family and regulates a variety of physiological processes. Prolactin is mainly associated with mammary gland development and lactation, has pleiotropic effects, and affects immune responses, metabolism, and behavior. CD81 Protein, Cynomolgus/Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD81 protein, expressed by HEK293 , with N-His labeled tag.

  • Molecular Formula

    102139656 (Gene_ID) A0A2K5UDJ9 (K116-K201) (Accession)

  • Smiles

    KDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLAALTTSVLKNNLCPSGSNIISNLLKKDCHQKIDELFSGK

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
5 µgQM-0202965-01
5 µgQM-0202965-01
£72.61/ea		 £0.00
£72.61/ea £0.00
10 µgQM-0202965-02
10 µgQM-0202965-02
£111.63/ea		 £0.00
£111.63/ea £0.00
50 µgQM-0202965-03
50 µgQM-0202965-03
£293.00/ea		 £0.00
£293.00/ea £0.00
100 µgQM-0202965-04
100 µgQM-0202965-04
£437.58/ea		 £0.00
£437.58/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

CD81, Cynomolgus/Rhesus Macaque (HEK293, His)

CD81, Cynomolgus/Rhesus Macaque (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.