Skip to product information
1 of 1

CD81, Human (His-SUMO)

CD81, Human (His-SUMO)

Size

SKU:QM-0103461

Price on request
Quantity

Request quote or documents

View full details
  • Description

    The CD19 receptor is critical for B cell activation, driving the trafficking and assembly of CD19-CR2 and BCR complexes, thereby lowering the antigenic threshold for B cell clonal expansion. In T cells, CD19 contributes to CD3 localization and influences polarization. CD81 Protein, Human (His-SUMO) is the recombinant human-derived CD81 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

  • Molecular Formula

    975 (Gene_ID) P60033 (F113-K201) (Accession)

  • Smiles

    FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0103461
1 EachQM-0103461
£0.00/ea
£0.00
£0.00/ea £0.00

CD81, Human (His-SUMO)

CD81, Human (His-SUMO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.