CD83, Human (HEK293, Fc)

Name: CD83, Human (HEK293, Fc)
Brand: QuantiMol
SKU: QM-0171702-01
Price: 216.46 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0171702-01

£216.46 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Human (HEK293, Fc) is the recombinant human-derived CD83 protein, expressed by HEK293 , with C-hFc labeled tag.
Molecular Formula
9308 (Gene_ID) Q01151 (T20-A143) (Accession)
Smiles
TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0171702-01	10 µgQM-0171702-01 £216.46/ea	£0.00	Quantity	£216.46/ea	£0.00

50 µgQM-0171702-02	50 µgQM-0171702-02 £492.26/ea	£0.00	Quantity	£492.26/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CD83, Human (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.