Skip to product information
1 of 1

CD83, Mouse (HEK293, Fc)

CD83, Mouse (HEK293, Fc)

Size

SKU:QM-0182185-01

£143.13 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    CD83 protein may be a key player in antigen presentation and cellular interactions during lymphocyte activation, highlighting its importance in immune processes. It potentially orchestrates antigen presentation and acts as a monomer. Investigating CD83's mechanisms in antigen presentation and lymphocyte activation could provide insights into its crucial role in shaping immune responses and cellular interactions within the immune system. CD83 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD83 protein, expressed by HEK293 , with C-hFc labeled tag.

  • Molecular Formula

    12522 (Gene_ID) O88324 (M22-A134) (Accession)

  • Smiles

    MREVTVACSETADLPCTAPWDPQLSYAVSWAKVSESGTESVELPESKQNSSFEAPRRRAYSLTIQNTTICSSGTYRCALQELGGQRNLSGTVVLKVTGCPKEATESTFRKYRA

  • Purity

    91

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0182185-01
10 µgQM-0182185-01
£143.13/ea
£0.00
£143.13/ea £0.00
50 µgQM-0182185-02
50 µgQM-0182185-02
£365.90/ea
£0.00
£365.90/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CD83, Mouse (HEK293, Fc)

CD83, Mouse (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.