Skip to product information
1 of 1

CD84/SLAMF5, Human (Biotinylated, HEK293, His-Avi)

CD84/SLAMF5, Human (Biotinylated, HEK293, His-Avi)

Size

SKU:QM-0128959

Price on request
Quantity

Request quote or documents

View full details
  • Description

    CD84/SLAMF5 protein is a self-ligand receptor in the SLAM family that regulates the activities of various immune cells through homotypic or heterotypic cell-cell interactions. It fine-tunes its function based on the presence or absence of small cytoplasmic adapter proteins, including SH2D1A/SAP and/or SH2D1B/EAT-2. CD84/SLAMF5 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD84/SLAMF5 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

  • Molecular Formula

    8832 (Gene_ID) Q9UIB8-1 (K22-R220) (Accession)

  • Smiles

    KDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFR

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0128959
1 EachQM-0128959
£0.00/ea
£0.00
£0.00/ea £0.00

CD84/SLAMF5, Human (Biotinylated, HEK293, His-Avi)

CD84/SLAMF5, Human (Biotinylated, HEK293, His-Avi) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.