CD84/SLAMF5, Human (Biotinylated, HEK293, His-Avi)
CD84/SLAMF5, Human (Biotinylated, HEK293, His-Avi)
SKU:QM-0128959
Request quote or documents

Product Details
-
Description
CD84/SLAMF5 protein is a self-ligand receptor in the SLAM family that regulates the activities of various immune cells through homotypic or heterotypic cell-cell interactions. It fine-tunes its function based on the presence or absence of small cytoplasmic adapter proteins, including SH2D1A/SAP and/or SH2D1B/EAT-2. CD84/SLAMF5 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD84/SLAMF5 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.
-
Molecular Formula
8832 (Gene_ID) Q9UIB8-1 (K22-R220) (Accession)
-
Smiles
KDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFR
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
CD84/SLAMF5, Human (Biotinylated, HEK293, His-Avi)
CD84/SLAMF5, Human (Biotinylated, HEK293, His-Avi) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.