Skip to product information
1 of 1

CD94, Human (HEK293, His)

CD94, Human (HEK293, His)

Size

SKU:QM-0178647-01

£235.90 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    CD94 protein is a key immune receptor for self-non-self discrimination. It forms a complex with KLRC1 or KLRC2 on lymphocyte subsets and recognizes HLA-E loaded with self-peptides. It allows cytotoxic cells to monitor MHC class I expression and promote self-tolerance. CD94 Protein, Human (HEK293, His) is the recombinant human-derived CD94 protein, expressed by HEK293 , with N-6*His labeled tag.

  • Molecular Formula

    3824 (Gene_ID) Q13241-1 (S34-I179) (Accession)

  • Smiles

    SFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI

  • Purity

    96.23

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0178647-01
10 µgQM-0178647-01
£235.90/ea
£0.00
£235.90/ea £0.00
50 µgQM-0178647-02
50 µgQM-0178647-02
£570.02/ea
£0.00
£570.02/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CD94, Human (HEK293, His)

CD94, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.