Skip to product information
1 of 1

CD99, Human (HEK293, Fc)

CD99, Human (HEK293, Fc)

Size

SKU:QM-0187683-01

£127.38 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The CD99 protein is involved in the important T cell adhesion process and helps red blood cells spontaneously form rosettes. It also contributes to the later stages of leukocyte extravasation, helping leukocytes to overcome the endothelial basement membrane during the immune response. CD99 Protein, Human (HEK293, Fc) is the recombinant human-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag.

  • Molecular Formula

    4267 (Gene_ID) P14209-1 (D23-D122) (Accession)

  • Smiles

    DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEAD

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0187683-01
10 µgQM-0187683-01
£127.38/ea
£0.00
£127.38/ea £0.00
50 µgQM-0187683-02
50 µgQM-0187683-02
£359.82/ea
£0.00
£359.82/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CD99, Human (HEK293, Fc)

CD99, Human (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.