Skip to product information
1 of 1

CDR2, Human (His)

CDR2, Human (His)

Size

SKU:QM-0167989

Price on request
Quantity

Request quote or documents

View full details
  • Description

    CDR2 protein is a member of the CDR2 family. CDR2 protein is primarily associated with paraneoplastic neurological diseases, specifically one called paraneoplastic cerebellar degeneration (PCD) . CDR2 Protein, Human (His) is the recombinant human-derived CDR2 protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    1039 (Gene_ID) Q01850 (M1-S454) (Accession)

  • Smiles

    MLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELGKTLLDRNTELEDSVQQMYTTNQEQLQEIEYLTKQVELLRQMNEQHAKVYEQLDVTARELEETNQKLVADSKASQQKILSLTETIECLQTNIDHLQSQVEELKSSGQGRRSPGKCDQEKPAPSFACLKELYDLRQHFVYDHVFAEKITSLQGQPSPDEEENEHLKKTVTMLQAQLSLERQKRVTMEEEYGLVLKENSELEQQLGATGAYRARALELEAEVAEMRQMLQSEHPFVNGVEKLVPDSLYVPFKEPSQSLLEEMFLTVPESHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVDTQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGVNAQSEPVASGWELASVNPEPVSSPTTPPEYKALFKEIFSCIKKTKQEIDEQRTKYRSLSSHS

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0167989
1 EachQM-0167989
£0.00/ea
£0.00
£0.00/ea £0.00

CDR2, Human (His)

CDR2, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.