CDR2, Human (His)
CDR2, Human (His)
SKU:QM-0167989
Request quote or documents

Product Details
-
Description
CDR2 protein is a member of the CDR2 family. CDR2 protein is primarily associated with paraneoplastic neurological diseases, specifically one called paraneoplastic cerebellar degeneration (PCD) . CDR2 Protein, Human (His) is the recombinant human-derived CDR2 protein, expressed by E. coli , with N-6*His labeled tag.
-
Molecular Formula
1039 (Gene_ID) Q01850 (M1-S454) (Accession)
-
Smiles
MLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELGKTLLDRNTELEDSVQQMYTTNQEQLQEIEYLTKQVELLRQMNEQHAKVYEQLDVTARELEETNQKLVADSKASQQKILSLTETIECLQTNIDHLQSQVEELKSSGQGRRSPGKCDQEKPAPSFACLKELYDLRQHFVYDHVFAEKITSLQGQPSPDEEENEHLKKTVTMLQAQLSLERQKRVTMEEEYGLVLKENSELEQQLGATGAYRARALELEAEVAEMRQMLQSEHPFVNGVEKLVPDSLYVPFKEPSQSLLEEMFLTVPESHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVDTQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGVNAQSEPVASGWELASVNPEPVSSPTTPPEYKALFKEIFSCIKKTKQEIDEQRTKYRSLSSHS
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
CDR2, Human (His)
CDR2, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.