CEACAM3, Human (His-SUMO)
CEACAM3, Human (His-SUMO)
SKU:QM-0129582
Request quote or documents

Product Details
-
Description
The CEACAM3 protein is a key granulocyte receptor that effectively orchestrates the opsonin-independent phagocytosis of CEACAM-bound microorganisms such as Neisseria spp., Moraxella spp., and Haemophilus spp. This role places CEACAM3 at the forefront of pathogen clearance in the innate immune system. CEACAM3 Protein, Human (His-SUMO) is the recombinant human-derived CEACAM3 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
-
Molecular Formula
1084 (Gene_ID) P40198 (K35-G155) (Accession)
-
Smiles
KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAG
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
CEACAM3, Human (His-SUMO)
CEACAM3, Human (His-SUMO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.