Skip to product information
1 of 1

CEACAM3, Human (His-SUMO)

CEACAM3, Human (His-SUMO)

Size

SKU:QM-0129582

Price on request
Quantity

Request quote or documents

View full details
  • Description

    The CEACAM3 protein is a key granulocyte receptor that effectively orchestrates the opsonin-independent phagocytosis of CEACAM-bound microorganisms such as Neisseria spp., Moraxella spp., and Haemophilus spp. This role places CEACAM3 at the forefront of pathogen clearance in the innate immune system. CEACAM3 Protein, Human (His-SUMO) is the recombinant human-derived CEACAM3 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

  • Molecular Formula

    1084 (Gene_ID) P40198 (K35-G155) (Accession)

  • Smiles

    KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAG

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0129582
1 EachQM-0129582
£0.00/ea
£0.00
£0.00/ea £0.00

CEACAM3, Human (His-SUMO)

CEACAM3, Human (His-SUMO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.