CEACAM7, Human (HEK293, His)

Name: CEACAM7, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0183783-01
Price: 232.25 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0183783-01

£232.25 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
CEAM7/CEACAM7 belongs to the class of carcinoembryonic antigen (CEA) proteins, a cell surface glycoprotein. CEACAM7 is dysregulated in hyperplastic colorectal polyps and early adenomas and may serve as a potential early diagnostic and/or prognostic marker for pancreatic cancer (PanCa) or pancreatic ductal adenocarcinoma (PDAC) . CEACAM7 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM7 protein, expressed by HEK293 , with C-6*His labeled tag.
Molecular Formula
1087 (Gene_ID) AAI21133.1 (T36-F142) (Accession)
Smiles
TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFYVF
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0183783-01	10 µgQM-0183783-01 £232.25/ea	£0.00	Quantity	£232.25/ea	£0.00

50 µgQM-0183783-02	50 µgQM-0183783-02 £599.18/ea	£0.00	Quantity	£599.18/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CEACAM7, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.