Skip to product information
1 of 1

CEBP gamma/CEBPG, Human (His)

CEBP gamma/CEBPG, Human (His)

Size

SKU:QM-0199790-01

£62.26 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    CEBP gamma/CEBPG protein is a transcription factor that regulates genes by binding to their promoter and enhancer regions. It targets IL-4 and immunoglobulin heavy chains, binding to enhancer elements PRE-I and GPE1 in the G-CSF gene promoter. CEBP gamma/CEBPG Protein, Human (His) is the recombinant human-derived CEBP gamma/CEBPG protein, expressed by E. coli , with N-His labeled tag.

  • Molecular Formula

    1054 (Gene_ID) P53567 (P39-N147) (Accession)

  • Smiles

    PGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDN

  • Purity

    94.7

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0199790-01
5 µgQM-0199790-01
£62.26/ea
£0.00
£62.26/ea £0.00
10 µgQM-0199790-02
10 µgQM-0199790-02
£97.00/ea
£0.00
£97.00/ea £0.00
50 µgQM-0199790-03
50 µgQM-0199790-03
£271.13/ea
£0.00
£271.13/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CEBP gamma/CEBPG, Human (His)

CEBP gamma/CEBPG, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.