Skip to product information
1 of 1

CEBPA, Human (His)

CEBPA, Human (His)

Size

SKU:QM-0200768-01

£58.12 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    CEBPA protein, also known as CCAAT/enhancer-binding protein α, is a transcription factor that plays a crucial role in regulating the expression of genes related to cell differentiation, proliferation, and metabolism. CEBPA Protein, Human (His) is the recombinant human-derived CEBPA protein, expressed by E. coli , with N-His labeled tag.

  • Molecular Formula

    1050 (Gene_ID) P49715-1 (M1-A358) (Accession)

  • Smiles

    MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHETSIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVMPGGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQPPPPPPPSHPHPHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPALGAAGLPGPGSALKGLGAAHPDLRASGGSGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA

  • Purity

    97

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0200768-01
5 µgQM-0200768-01
£58.12/ea
£0.00
£58.12/ea £0.00
10 µgQM-0200768-02
10 µgQM-0200768-02
£72.61/ea
£0.00
£72.61/ea £0.00
50 µgQM-0200768-03
50 µgQM-0200768-03
£205.52/ea
£0.00
£205.52/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CEBPA, Human (His)

CEBPA, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.