Skip to product information
1 of 1

CELA2A, Mouse (His)

CELA2A, Mouse (His)

Size

SKU:QM-0130533

Price on request
Quantity

Request quote or documents

View full details
  • Description

    CELA2A Protein, a serine protease, is involved in the digestion of dietary proteins in the small intestine. It cleaves peptide bonds, breaking down proteins into smaller peptides and amino acids for absorption. CELA2A Protein, Mouse (His) is the recombinant mouse-derived CELA2A protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    13706 (Gene_ID) P05208 (V31-N271) (Accession)

  • Smiles

    VVGGQEATPNTWPWQVSLQVLSSGRWRHNCGGSLVANNWVLTAAHCLSNYQTYRVLLGAHSLSNPGAGSAAVQVSKLVVHQRWNSQNVGNGYDIALIKLASPVTLSKNIQTACLPPAGTILPRNYVCYVTGWGLLQTNGNSPDTLRQGRLLVVDYATCSSASWWGSSVKSSMVCAGGDGVTSSCNGDSGGPLNCRASNGQWQVHGIVSFGSSLGCNYPRKPSVFTRVSNYIDWINSVMARN

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0130533
1 EachQM-0130533
£0.00/ea
£0.00
£0.00/ea £0.00

CELA2A, Mouse (His)

CELA2A, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.