Skip to product information
1 of 1

CEMP1, Human (P.pastoris, His)

CEMP1, Human (P.pastoris, His)

Size

SKU:QM-0127078

Price on request
Quantity

Request quote or documents

View full details
  • Description

    CEMP1 protein may play a key role in the development of periodontal tissue, promoting the differentiation of periodontal ligament cells into cementoblasts and promoting cementum formation. CEMP1 exhibits affinity for hydroxyapatite, suggesting involvement in cementum biomineralization. CEMP1 Protein, Human (P.pastoris, His) is the recombinant human-derived CEMP1 protein, expressed by P. pastoris , with N-His labeled tag.

  • Molecular Formula

    752014 (Gene_ID) Q6PRD7 (M1-G247) (Accession)

  • Smiles

    MGTSSTDSQQAGHRRCSTSNTSAENLTCLSLPGSPGKTAPLPGPAQAGAGQPLPKGCAAVKAEVGIPAPHTSQEVRIHIRRLLSWAAPGACGLRSTPCALPQALPQARPCPGRWFFPGCSLPTGGAQTILSLWTWRHFLNWALQQREENSGRARRVPPVPRTAPVSKGEGSHPPQNSNGEKVKTITPDVGLHQSLTSDPTVAVLRAKRAPEAHPPRSCSGSLTARVCHMGVCQGQGDTEDGRMTLMG

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0127078
1 EachQM-0127078
£0.00/ea
£0.00
£0.00/ea £0.00

CEMP1, Human (P.pastoris, His)

CEMP1, Human (P.pastoris, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.