Skip to product information
1 of 1

CEP57, Human (His)

CEP57, Human (His)

Size

SKU:QM-0202346-01

£62.26 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    CEP57 is a centrosomal protein that is a potential player in promoting microtubule attachment to centrosomes, possibly by forming a ring-like structure around microtubules. The protein exhibits homodimer and homooligomer formation and interacts with microtubules. CEP57 Protein, Human (GST) is the recombinant human-derived CEP57 protein, expressed by E. coli , with N-GST labeled tag.

  • Molecular Formula

    9702 (Gene_ID) Q86XR8 (S118-R226) (Accession)

  • Smiles

    SKNEESKHNQELTSQLLAAENKCNLLEKQLEYMRNMIKHAEMERTSVLEKQVSLERERQHDQTHVQSQLEKLDLLEQEYNKLTTMQALAEKKMQELEAKLHEEEQERKR

  • Purity

    97

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0202346-01
5 µgQM-0202346-01
£62.26/ea
£0.00
£62.26/ea £0.00
10 µgQM-0202346-02
10 µgQM-0202346-02
£97.00/ea
£0.00
£97.00/ea £0.00
50 µgQM-0202346-03
50 µgQM-0202346-03
£271.13/ea
£0.00
£271.13/ea £0.00
100 µgQM-0202346-04
100 µgQM-0202346-04
£426.65/ea
£0.00
£426.65/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CEP57, Human (His)

CEP57, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.