Skip to product information
1 of 1

CG alpha, Human (HEK293)

CG alpha, Human (HEK293)

Size

SKU:QM-0204623-01

£67.44 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    CG alpha, a glycoprotein hormone subunit, contributes to chorionic gonadotropin, luteinizing hormone, follicle-stimulating hormone, and thyroid-stimulating hormone. While alpha subunits are identical, beta chains confer specificity. Encoded by this gene, CG alpha belongs to the glycoprotein hormones alpha chain family. Restrictedly expressed in the placenta (RPKM 388.3) . Two transcript variants exist. CG alpha Protein, Human (HEK293) is the recombinant human-derived CG alpha protein, expressed by HEK293 , with tag free.

  • Molecular Formula

    1081 (Gene_ID) NP_000726.1 (A25-S116) (Accession)

  • Smiles

    APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0204623-01
2 µgQM-0204623-01
£67.44/ea
£0.00
£67.44/ea £0.00
10 µgQM-0204623-02
10 µgQM-0204623-02
£188.51/ea
£0.00
£188.51/ea £0.00
50 µgQM-0204623-03
50 µgQM-0204623-03
£437.58/ea
£0.00
£437.58/ea £0.00
100 µgQM-0204623-04
100 µgQM-0204623-04
£708.53/ea
£0.00
£708.53/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CG alpha, Human (HEK293)

CG alpha, Human (HEK293) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.