Skip to product information
1 of 1

β-CGRP, human (acetate)

β-CGRP, human (acetate)

Size

SKU:QM-0118796

Price on request
Quantity

Request quote or documents

View full details
  • Description

    β-CGRP, human acetate (Human β-CGRP acetate) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells[1].

  • Molecular Formula

    C162H267N51O48S3.xC2H4O2

  • Smiles

    [ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2(Disulfidebridge:Cys2-Cys7)(acetate)]

  • Target

    CGRP Receptor

  • Solubility

    H2O

  • Shipping Conditions

    Room temperature

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0118796
1 EachQM-0118796
£0.00/ea
£0.00
£0.00/ea £0.00

β-CGRP, human (acetate)

β-CGRP, human (acetate) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.