Skip to product information
1 of 1

β-CGRP, human (TFA)

β-CGRP, human (TFA)

Size

SKU:QM-0198536-01

£238.32 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    β-CGRP, human TFA (Human β-CGRP TFA) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells[1].

  • Molecular Formula

    C162H267N51O48S3.xC2HF3O2

  • Smiles

    [ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2(Disulfidebridge:Cys2-Cys7)(TFAsalt)]

  • Target

    CGRP Receptor

  • Purity

    99.57

  • Solubility

    H2O : 100 mg/mL (ultrasonic)

  • Storage Conditions

    -80°C, 2 years; -20°C, 1 year (Powder, sealed storage, away from moisture)

  • Shipping Conditions

    Blue Ice

Your cart
Variant Variant total Quantity Price Variant total
500 µgQM-0198536-01
500 µgQM-0198536-01
£238.32/ea
£0.00
£238.32/ea £0.00
1 mgQM-0198536-02
1 mgQM-0198536-02
£388.99/ea
£0.00
£388.99/ea £0.00
5 mgQM-0198536-03
5 mgQM-0198536-03
£1,229.77/ea
£0.00
£1,229.77/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

β-CGRP, human (TFA)

β-CGRP, human (TFA) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.