Name: Chemerin/RARRES2, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0201250-01
Price: 81.92 GBP
Availability: InStock

Product Details

Description
Chemerin/RARRES2 protein is an adipokine secreted by adipocytes that is activated by CMKLR1 and serves as a CMKLR2 ligand to complexly regulate adipogenesis, metabolism, and inflammation. It actively regulates adipocyte differentiation, affects lipid and glucose metabolism, and plays a role in angiogenesis. Chemerin/RARRES2 Protein, Human (HEK293, His) is the recombinant human-derived Chemerin/RARRES2 protein, expressed by HEK293 , with C-6*His labeled tag.
Molecular Formula
5919 (Gene_ID) Q99969 (E21-S157) (Accession)
Smiles
ELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFS
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0201250-01	5 µgQM-0201250-01 £81.92/ea	£0.00	Quantity	£81.92/ea	£0.00

10 µgQM-0201250-02	10 µgQM-0201250-02 £127.38/ea	£0.00	Quantity	£127.38/ea	£0.00

50 µgQM-0201250-03	50 µgQM-0201250-03 £327.02/ea	£0.00	Quantity	£327.02/ea	£0.00

100 µgQM-0201250-04	100 µgQM-0201250-04 £492.26/ea	£0.00	Quantity	£492.26/ea	£0.00

250 µgQM-0201250-05	250 µgQM-0201250-05 £913.87/ea	£0.00	Quantity	£913.87/ea	£0.00

500 µgQM-0201250-06	500 µgQM-0201250-06 £1,433.88/ea	£0.00	Quantity	£1,433.88/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Chemerin/RARRES2, Human (HEK293, His)

Chemerin/RARRES2, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.