Skip to product information
1 of 1

Chemerin/RARRES2, Mouse (HEK293, His)

Chemerin/RARRES2, Mouse (HEK293, His)

Size

SKU:QM-0199227-01

£122.00 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Chemerin/RARRES2 proteins bind to signaling receptors and are involved in various processes, including promotion of adipocyte differentiation, protein phosphorylation, and insulin receptor signaling. It plays a role in brown adipocyte differentiation and is located in the extracellular region. Chemerin/RARRES2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Chemerin/RARRES2 protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    71660 (Gene_ID) Q9DD06/NP_082128.1 (T17-S156) (Accession)

  • Smiles

    MKCLLISLALWLGTVGTRGTEPELSETQRRSLQVALEEFHKHPPVQLAFQEIGVDRAEEVLFSAGTFVRLEFKLQQTNCPKKDWKKPECTIKPNGRRRKCLACIKMDPKGKILGRIVHCPILKQGPQDPQELQCIKIAQAGEDPHGYFLPGQFAFS

  • Purity

    94.9

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0199227-01
5 µgQM-0199227-01
£122.00/ea
£0.00
£122.00/ea £0.00
10 µgQM-0199227-02
10 µgQM-0199227-02
£168.13/ea
£0.00
£168.13/ea £0.00
50 µgQM-0199227-03
50 µgQM-0199227-03
£456.51/ea
£0.00
£456.51/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Chemerin/RARRES2, Mouse (HEK293, His)

Chemerin/RARRES2, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.