CHODL, Rat (HEK293, His)

Name: CHODL, Rat (HEK293, His)
Brand: QuantiMol
SKU: QM-0194892-01
Price: 68.47 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg

SKU:QM-0194892-01

£68.47 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
CHODL proteins contribute significantly to nervous system development, particularly in neurite growth and elongation. There is evidence that it is involved in guiding motor axon growth and shaping the structural framework of the nervous system. CHODL Protein, Rat (HEK293, His) is the recombinant rat-derived CHODL protein, expressed by HEK293 , with C-His labeled tag.
Molecular Formula
288289 (Gene_ID) D3ZI86 (R22-N216) (Accession)
Smiles
RRVVSGQKVCFADVKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLSLENEAEQKLIESMLQNLTKPGTGISDGDFWIGLLRSGDGQTSGACPDLYQWSDGSSSQFRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKYEPEIHPTEPVEKPYLTNQPEDTHENVVVTEAGIIPN
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0194892-01	5 µgQM-0194892-01 £68.47/ea	£0.00	Quantity	£68.47/ea	£0.00

10 µgQM-0194892-02	10 µgQM-0194892-02 £101.50/ea	£0.00	Quantity	£101.50/ea	£0.00

50 µgQM-0194892-03	50 µgQM-0194892-03 £288.14/ea	£0.00	Quantity	£288.14/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CHODL, Rat (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.