Skip to product information
1 of 1

CHRNA1, Human (His-Trx)

CHRNA1, Human (His-Trx)

Size

SKU:QM-0169205-01

£146.50 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The CHRNA1 Protein undergoes a substantial conformational shift upon acetylcholine binding, influencing all subunits and leading to the activation of an ion-conducting channel. Yet, the acetylcholine receptor alpha subunit of CHRNA1 can be non-functional in certain cases, underscoring the need to comprehend the factors governing its functionality and integration into fully operational acetylcholine-gated cation-selective channels. CHRNA1 Protein, Human (His-Trx) is the recombinant human-derived CHRNA1 protein, expressed by E. coli , with N-Trx, N-6*His labeled tag.

  • Molecular Formula

    1134 (Gene_ID) P02708 (S21-L255) (Accession)

  • Smiles

    SEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRL

  • Purity

    90

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0169205-01
5 µgQM-0169205-01
£146.50/ea
£0.00
£146.50/ea £0.00
10 µgQM-0169205-02
10 µgQM-0169205-02
£274.77/ea
£0.00
£274.77/ea £0.00
50 µgQM-0169205-03
50 µgQM-0169205-03
£678.15/ea
£0.00
£678.15/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CHRNA1, Human (His-Trx)

CHRNA1, Human (His-Trx) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.