CHRNB3, Human (HEK293, His)
CHRNB3, Human (HEK293, His)
SKU:QM-0096751
Request quote or documents

Product Details
-
Description
CHRNB3 Protein, a vital constituent of the acetylcholine receptor (AChR), induces a significant conformational shift upon acetylcholine binding. This change affects all subunits, leading to the activation of an ion-conducting channel across the plasma membrane. The neuronal AChR complex comprises alpha and beta subunits, emphasizing their intricate collaboration in responding to acetylcholine stimulation. CHRNB3 Protein, Human (HEK293, His) is the recombinant human-derived CHRNB3 protein, expressed by HEK293 , with C-6*His labeled tag.
-
Molecular Formula
1142 (Gene_ID) Q05901 (I25-L232) (Accession)
-
Smiles
IAENEDALLRHLFQGYQKWVRPVLHSNDTIKVYFGLKISQLVDVDEKNQLMTTNVWLKQEWTDHKLRWNPDDYGGIHSIKVPSESLWLPDIVLFENADGRFEGSLMTKVIVKSNGTVVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFITYSFVLRRL
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
CHRNB3, Human (HEK293, His)
CHRNB3, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.