Skip to product information
1 of 1

CHRNB3, Human (HEK293, His)

CHRNB3, Human (HEK293, His)

Size

SKU:QM-0096751

Price on request
Quantity

Request quote or documents

View full details
  • Description

    CHRNB3 Protein, a vital constituent of the acetylcholine receptor (AChR), induces a significant conformational shift upon acetylcholine binding. This change affects all subunits, leading to the activation of an ion-conducting channel across the plasma membrane. The neuronal AChR complex comprises alpha and beta subunits, emphasizing their intricate collaboration in responding to acetylcholine stimulation. CHRNB3 Protein, Human (HEK293, His) is the recombinant human-derived CHRNB3 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    1142 (Gene_ID) Q05901 (I25-L232) (Accession)

  • Smiles

    IAENEDALLRHLFQGYQKWVRPVLHSNDTIKVYFGLKISQLVDVDEKNQLMTTNVWLKQEWTDHKLRWNPDDYGGIHSIKVPSESLWLPDIVLFENADGRFEGSLMTKVIVKSNGTVVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFITYSFVLRRL

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0096751
1 EachQM-0096751
£0.00/ea
£0.00
£0.00/ea £0.00

CHRNB3, Human (HEK293, His)

CHRNB3, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.