Skip to product information
1 of 1

CIAP1/BIRC2, Human (Avi)

CIAP1/BIRC2, Human (Avi)

Size

SKU:QM-0027626

Price on request
Quantity

Request quote or documents

View full details
  • Description

    CIAP1/BIRC2 Protein, Human (Avi) is the recombinant human-derived cIAP1/BIRC2 protein, expressed by E. coli, with C-Avi tag.

  • Molecular Formula

    329 (Gene_ID) NP_001157.1 (N-G&P, E144-L356) (Accession)

  • Smiles

    EHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPLTFLSPSELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLL

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0027626
1 EachQM-0027626
£0.00/ea
£0.00
£0.00/ea £0.00

CIAP1/BIRC2, Human (Avi)

CIAP1/BIRC2, Human (Avi) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.