CIB2, Human (His, solution)

Name: CIB2, Human (His, solution)
Brand: QuantiMol
SKU: QM-0200814-01
Price: 97.61 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg

SKU:QM-0200814-01

£97.61 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
CIB2 protein: Calcium and integrin-binding protein involved in intracellular calcium regulation, auditory hair cell mechanotransduction, and maintenance of stereocilia bundle morphology. CIB2 Protein, Human (His, solution) is the recombinant human-derived CIB2, expressed by E. coli, with N-6*His labeled tag.
Molecular Formula
10518 (Gene_ID) O75838-1 (M1-I187) (Accession)
Smiles
MGNKQTIFTEEQLDNYQDCTFFNKKDILKLHSRFYELAPNLVPMDYRKSPIVHVPMSLIIQMPELRENPFKERIVAAFSEDGEGNLTFNDFVDMFSVLCESAPRELKANYAFKIYDFNTDNFICKEDLELTLARLTKSELDEEEVVLVCDKVIEEADLDGDGKLGFADFEDMIAKAPDFLSTFHIRI
Purity
98
Storage Conditions
Stored at -80°C for 1 year
Shipping Conditions
Dry ice

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0200814-01	5 µgQM-0200814-01 £97.61/ea	£0.00	Quantity	£97.61/ea	£0.00

10 µgQM-0200814-02	10 µgQM-0200814-02 £132.13/ea	£0.00	Quantity	£132.13/ea	£0.00

50 µgQM-0200814-03	50 µgQM-0200814-03 £309.50/ea	£0.00	Quantity	£309.50/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CIB2, Human (His, solution) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.